PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_16875-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 181aa    MW: 20378.5 Da    PI: 4.7025
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_16875-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-16855148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+  + ++G g+W++++r  g++R++k+c++rw++yl
  TRIUR3_16875-P1  8 KGLWSPEEDEKLYSHILRYGVGCWSSVPRLAGLHRCGKSCRLRWLNYL 55
                     678*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.817359IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-20654IPR009057Homeodomain-like
SMARTSM007173.9E-13757IPR001005SANT/Myb domain
PfamPF002491.0E-14855IPR001005SANT/Myb domain
SuperFamilySSF466891.51E-181074IPR009057Homeodomain-like
CDDcd001677.31E-111155No hitNo description
Gene3DG3DSA:1.10.10.602.8E-45572IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MQQPKLRKGL WSPEEDEKLY SHILRYGVGC WSSVPRLAGL HRCGKSCRLR WLNYLRPDLK  60
RGTFSQEEED HIELTVAYAA AFYGQFGGGK EGADDDAGFG TGDYSCVLGV SENLGYGESS  120
SNSSNWNYGG EVGSVLDGEV LHWAKAEMER QHDEPPEHKF ALPCQEQSLL ANFEFNLEQY  180
F
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0669465e-99KM066946.1 Triticum aestivum R2R3-MYB transcription factor (MYB86) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961344.14e-39PREDICTED: myb-related protein Hv33-like
SwissprotP200275e-44MYB3_HORVU; Myb-related protein Hv33
TrEMBLM7YLM71e-133M7YLM7_TRIUA; Myb-related protein Hv33
STRINGSi022730m1e-38(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3760022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-35myb domain protein 86